PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp3g15120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GATA
Protein Properties Length: 184aa    MW: 19751.2 Da    PI: 9.0425
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp3g15120genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.51.9e-184478135
       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
               C+ Cgt+ TplWR gp g+k+LCnaCG++ rkk++
  Tp3g15120 44 CVDCGTIRTPLWRGGPAGPKSLCNACGIKSRKKRQ 78
               *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.7E-123893IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.2153874IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-113980No hitNo description
Gene3DG3DSA:3.30.50.106.6E-154278IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.37E-114377No hitNo description
PROSITE patternPS0034404469IPR000679Zinc finger, GATA-type
PfamPF003203.3E-164478IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MSEGSEETKT KVDSAGELSD VDNENCSSSG SGGGGSCGET KRTCVDCGTI RTPLWRGGPA  60
GPKSLCNACG IKSRKKRQAA LGMKPEEKKK NKKCNSSNND ISFDHRNAKN KINKDGDDDD  120
DDDRSKSSSS CCSSKGVSKF LNLGFKVPVM KRSAVEKKRL WRKLGEEERA AVLLMALSCG  180
SVYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188312.16e-85GATA transcription factor 17
SwissprotQ9LIB58e-87GAT17_ARATH; GATA transcription factor 17
TrEMBLQ0WPA17e-85Q0WPA1_ARATH; Putative uncharacterized protein At3g16870
STRINGAT3G16870.12e-84(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126431528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16870.17e-75GATA transcription factor 17